RP01876
Recombinant Mouse IL-19 Protein
Size
£133.00
- SKU:
- RP01876
- Additional Names:
- Interleukin-19, IL-19, Il19
- Molecular Weight:
- 55-65 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Leu25-Ala176
- Formulation:
- Recombinant Mouse IL19 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Ala176) of Mouse IL19 (Accession #NP_001009940.1) fused with a hFc tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Uniprot:
- Q8CJ70
- Synonyms:
- IL-19;interleukin-19
- Extra Details:
- IL-19 shares 21% amino acid identity with IL-10. The exon/intron structure of IL-19 is similar to that of the human IL-10 gene, comprising five exons and four introns within the coding region of the IL-19 cDNA. IL-19 does not bind or signal through the canonical IL-10 receptor complex. IL-19 functions through a receptor complex composed of IL-20Ra and IL20Rb that is also utilized by IL-20 and IL-24. IL19 has been shown to enhance the production of Th2 cytokines in Tcells and to be elevated in asthma patients. Furthermore, it induces IL-6, IL-8 and IL-10 expression in monocytes. Additionally, it has been implicated in a range of diseases and disorders, including aging, Type-I diabetes, endotoxic shock, periodontal disease, vascular disease and rheumatoid arthritis.
- Shipping Conditions:
- Blue Ice