Recombinant Mouse RETN Protein

Size

£133.00

SKU:: RP01873
Additional Names:: Resistin, Adipose tissue-specific secretory factor, ADSF, Adipose-specific cysteine-rich secreted protein A12-alpha, Cysteine-rich secreted protein FIZZ3, Retn, Fizz3
Molecular Weight:: 35-45 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser21-Ser114
Formulation:: Recombinant Mouse RETN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Ser114 ) of Mouse RETN (Accession #NP_075360.1) fused with hFc tag at the N-terminus.
Species:: Mouse
Sequence:: SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Uniprot:: Q99P87
Synonyms:: AD;adipose tissue-specific secretory factor;adipose-specific cysteine-rich secreted protein A12-alpha;ADSF;cysteine-rich secreted protein FIZZ3;dominant inhibitory adipocyte-specific secretory factor;Fizz;Fizz3;found in inflammatory zone 3;r;resistin;Rstn;Xcp;Xcp4
Extra Details:: Resistin is an adipocytokine, which has been studied for its role in insulin resistance and recently in inflammation. The RETN and CAP1 polymorphisms and gene expression may be potential biomarkers for breast cancer risk. Resistin (RETN), recently found to be relevant to inflammation and inflammatory disorders.