RP01871
Recombinant Human CD81 Protein
Size
£133.00
- SKU:
- RP01871
- Additional Names:
- CD81 antigen, 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28, Tspan-28, CD81, CD81, TAPA1, TSPAN28
- Molecular Weight:
- 35-45 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Phe113-Lys201
- Formulation:
- Recombinant Human CD81 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe113-Lys201 ) of Human CD81 (Accession #NP_004347.1) fused with hFc tag at the N-terminus.
- Species:
- Human
- Sequence:
- FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
- Uniprot:
- P60033
- Synonyms:
- 26 kDa cell surface protein TAPA-1;CD81 antigen;CD81 antigen (target of antiproliferative antibody 1);CVID6;S5.7;TAPA1;Target of the antiproliferative antibody 1;tetraspanin-28;tspan-28;TSPAN28
- Extra Details:
- CD81, belongs to the transmembrane 4 superfamily, also known as the tetraspanin family. Members of this family mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. It is related to adhesion, morphology, activation, proliferation, and differentiation of B, T, and other cells. On B cells CD81 is part of a complex with CD21, CD19, and Leu13. This complex reduces the threshold for B cell activation via the B cell receptor by bridging Ag specific recognition and CD21-mediated complement recognition.
- Shipping Conditions:
- Blue Ice