Recombinant Human C1QC Protein

Size

£181.00

SKU:: RP01865
Additional Names:: C1Q-C|C1QD3|C1QG|Complement C1q subcomponent subunit C
Molecular Weight:: 45-50 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asn29-Asp245
Formulation:: Recombinant HumanC1QC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn29-Asp245) of human ENPP-1 (Accession #P02747) fused with 6xHis and hFc tag at the N-terminus.
Species:: Human
Sequence:: NTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Uniprot:: P02747
Synonyms:: C1Q-C;C1QG;complement C1q subcomponent subunit C;complement component 1, q subcomponent, C chain;complement component 1, q subcomponent, gamma polypeptide
Extra Details:: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.