RP01848
Recombinant Mouse FGF-10 Protein

Size
£163.00
- SKU:
- RP01848
- Additional Names:
- Fibroblast growth factor 10, FGF-10, Keratinocyte growth factor 2,Fgf10
- Molecular Weight:
- 20-25 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gln37-Thr209
- Formulation:
- Recombinant Mouse FGF-10 Protein is produced by E. coli expression systerm. The target protein is expressed with sequence (Gln37-Thr209) of Mouse FGF-10 (Accession #NP_032028.1) fused with no tag.
- Species:
- Mouse
- Sequence:
- QALGQDMVSQEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
- Uniprot:
- O35565
- Synonyms:
- AEY1;AEY17;BB213776;Fgf-10;Fgf5a;fibroblast growth factor 10;fibroblast growth factor 5a;Gsfaey;Gsfaey17;keratinocyte growth factor 2
- Extra Details:
- Fibroblast Growth Factor 10 (FGF 10) is an evolutionary conserved secreted growth factor mediating mostly mesenchymal to epithelial signaling. FGF 10 belongs to the FGF 7 subfamily and shares similar biochemical and amino acid sequences with its constituent members (FGF3, FGF 7 and FGF 22). As a paracrine FGF, FGF 10 elicits its biological responses by activating the fibroblast growth factor receptor 2b (FGF R 2b), is crucial for governing proximal distal outgrowth as well as patterning and acts upstream of the known apical ectodermal ridge (AER) marker FGF 8. FGF10 is also implicated in pancreatic cancer, and that overexpression of FGFR2b is associated with metastatic invasion.
- Shipping Conditions:
- Blue Ice



