RP01846
Recombinant Mouse TGF-alpha Protein
Size
£145.00
- SKU:
- RP01846
- Additional Names:
- Protransforming growth factor alpha, Cleaved into: Transforming growth factor alpha, TGF-alpha, EGF-like TGF, ETGF, TGF type 1, Tgfa
- Molecular Weight:
- 35-45 kDa
- Purity:
- 85%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala38-Ala88
- Formulation:
- Recombinant Mouse TGF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala38-Ala88) of Mouse TGF-alpha/TGFA (Accession #NP_112476.1) fused with a hFc tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- SPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA
- Uniprot:
- P48030
- Synonyms:
- protransforming growth factor alpha;wa-1;wa1
- Extra Details:
- Transforming growth factor alpha (TGF-A Alpha) is a protein that in humans is encoded by the TGFA gene. TGF-alpha is a member of the EGF family of cytokines that are synthesized as transmembrane precursors and are characterized by the presence of one or several EGF structural units in their extracellular domain. Expression of TGF-alpha is widespread in tumors and transformed cells. TGF-alpha is also expressed in normal tissues during embryogenesis and in adult tissues, including pituitary, brain, keratinocytes, and macrophages.TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
- Shipping Conditions:
- Blue Ice