Recombinant Human Angiopoietin-like 3/ANGPTL3(237-460) Protein

Size

£113.05

Was £133.00

SKU:: RP01831
Additional Names:: ANG-5|Angiopoietin-like 3|ANGPT5|ANGPTL3|ANL3|FHBL2
Molecular Weight:: 35-40 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val237-Glu460
Formulation:: Recombinant Human Angiopoietin-like 3/ANGPTL3(237-460) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val237-Glu460) of human Angiopoietin-like 3/ANGPTL3 (Accession #NP_055310.1) fused with a 6xHis tag at the
Species:: Human
Sequence:: VKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Uniprot:: Q9Y5C1
Synonyms:: ANG-5;angiopoietin 5;Angiopoietin-5;Angiopoietin-like protein 3;angiopoietin-related protein 3;ANGPT5;ANL3;FHBL2
Extra Details:: ANGPTL3 is a secreted glycoprotein that is structurally related to the angiopoietins. Mature human ANGPTL3 contains an N-terminal coiled coil domain and a C-terminal fibrinogen-like domain. ANGPTL3 is expressed in the liver from early in development through adulthood. Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism. Proposed to play a role in the trafficking of energy substrates to either storage or oxidative tissues in response to food intake.

Shipping Conditions:: Blue Ice