Recombinant Mouse Macrophage migration inhibitory factor/MIF Protein

Size

£133.00

SKU:: RP01829
Additional Names:: DER6|GIF|Glif; Macrophage migration inhibitory factor; MIF
Molecular Weight:: 15 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Pro2-Ala115
Formulation:: Recombinant Mouse Macrophage migration inhibitory factor/MIF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro2-Ala115) of mouse Macrophage migration inhibitory factor/MIF (Accession #NP_034928.1)
Species:: Mouse
Sequence:: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Uniprot:: P34884
Synonyms:: delayed early response protein 6;DER6;GIF;Gl;Glif;Glycosylation-inhibiting factor;L-dopachrome isomerase;L-dopachrome tautomerase;macrophage migration inhibitory factor;phenylpyruvate tautomerase
Extra Details:: MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era (1, 2). Regardless, it is one of the least understood of all inflammatory mediators (1, 3). Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without a signal sequence (4 - 7). Secretion occurs nonclassically via an ABCA1 transporter (8). The initiating Met is removed, leaving Pro as the first amino acid. The molecule consists of two alpha -helices and six beta -strands, four of which form a beta -sheet. The two remaining beta -strands interact with other MIF molecules, creating a trimer (2, 9, 10). Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position #1 (11). Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity (12).

Shipping Conditions:: Blue Ice