Recombinant Human Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein

Size

£123.25

Was £145.00

SKU:: RP01828
Additional Names:: AGP1|AGPT|AGPT-1; Angiopoietin-1; ANG-1; ANGPT1|ANG1|HAE5
Molecular Weight:: 30-35 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Arg277-Phe498
Formulation:: Recombinant Human Angiopoietin-1/ANG-1/ANGPT1(277-498) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg277-Phe498) of human Angiopoietin-1/ANG-1/ANGPT1 (Accession #NP_001137.2) fused with a 6xHis tag at the
Species:: Human
Sequence:: KREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
Uniprot:: Q15389-1
Synonyms:: AGP1;AGPT;ANG-1;ANG1;angiopoietin-1;HAE5
Extra Details:: The angiopoietin (ANGPT)-TIE2/TEK signaling pathway is essential for blood and lymphatic vascular homeostasis. ANGPT1 is a potent TIE2 activator, whereas ANGPT2 functions as a context-dependent agonist/antagonist. In disease, ANGPT2-mediated inhibition of TIE2 in blood vessels is linked to vascular leak, inflammation, and metastasis.