RP01825
Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein
Size
£133.00
- SKU:
- RP01825
- Additional Names:
- ARIA|GGF|GGF2|HGL|HRG|HRG1|HRGA|MST131|MSTP131|NDF|NRG1-IT2|NRG1 (Beta1) |Pro-neuregulin-1|SMDF
- Molecular Weight:
- 10-15 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Thr 176-Lys 246
- Formulation:
- Recombinant Human Pro-neuregulin-1/NRG1 (Beta1) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Thr 176-Lys 246) of human Pro-neuregulin-1/NRG1 (Beta1) (Accession #NP_039250.2) fused with no tag.
- Species:
- Human
- Sequence:
- TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK
- Uniprot:
- Q02297-6
- Synonyms:
- acetylcholine receptor-inducing activity;ARIA;GGF;GGF2;glial growth factor 2;heregulin, alpha (45kD, ERBB2 p185-activator);HGL;HRG;HRG1;HRGA;MST131;MSTP131;NDF;neu differentiation factor;NRG1-IT2;pro-neuregulin-1, membrane-bound isoform;pro-NRG1;sensory and motor neuron derived factor;SMDF
- Extra Details:
- neuregulin-1 (heregulin-1, NRG1) is a member of neuregulin family, which is comprised of four genes thatencode a large number of secreted or membrane-bound isoforms. All family members share an EGF-likedomain that interacts with the ErbB family of tyrosine kinase receptors. NRG1 isoforms can be classified intotype I, type II and type III isoforms. NRG1 directs ligand for ERBB3 and ERBB4 tyrosine kinase receptors,concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylationand activation of the ERBB receptors. NRG proteins show distinct spatial and temporal expression patterns andplay important roles during development of both the nervous system and the heart.
- Shipping Conditions:
- Blue Ice