Recombinant Human FSH Beta Protein

Size

£163.00

SKU:: RP01821
Additional Names:: FSH Beta|FSHB|HH24
Molecular Weight:: 20-25 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asn19-Glu129
Formulation:: Recombinant Human FSH Beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn19-Glu129) of human FSH Beta (Accession #NP_000501.1) fused with a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Uniprot:: P01225
Synonyms:: follicle stimulating hormone beta subunit;follicle stimulating hormone, beta polypeptide;Follicle-stimulating hormone beta subunit;Follitropin beta chain;follitropin subunit beta;follitropin, beta chain;FSH-B;FSH-beta;HH24
Extra Details:: Follicle-stimulating hormone (FSH) is a gonadotrope-derived heterodimeric glycoprotein. FSH plays an essential role in processes involved in human reproduction, including spermatogenesis and the ovarian cycle. FSHB represents a conservative vertebrate gene with a unique function and it is located in a structurally stable gene-poor region. Polymorphisms in the follicle stimulating hormone beta subunit (FSHB) and follicle stimulating hormone receptor (FSHR) genes might disturb normal spermatogenesis and affect male reproductive ability. The FSHB -211G>T genotype is a key determinant in the regulation of gonadotropins in different reproductive-endocrine pathopyhsiologies.

Shipping Conditions:: Blue Ice