RP01815
Recombinant Human CD320 Protein

Size
£133.00
- SKU:
- RP01815
- Additional Names:
- 8D6|8D6A|CD320|sCD320|TCBLR|TCII-R|TCN2R
- Molecular Weight:
- 35-45 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala31-Thr704
- Formulation:
- Recombinant Human CD320 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser36-Val231) of human CD320 (Accession #NP_057663.1) fused with a His tag at the C-terminus.
- Species:
- Human
- Sequence:
- SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV
- Uniprot:
- Q9NPF0-1
- Synonyms:
- 8D6;8D6 antigen;8D6A;CD320 antigen;FDC-signaling molecule 8D6;FDC-SM-8D6;TCBLR;TCN2R;transcobalamin 2 receptor;transcobalamin receptor
- Extra Details:
- CD320 is a heavily glycosylated protein that is expressed as a noncovalent dimer in the kidney, placenta, liver, intestine, and secondary lymphoid organs (3 - 5). It functions as an endocytic receptor for circulating complexes of Cobalamin (Vitamin B12) and Transcobalamin II. In the immune system, CD320 is expressed by germinal center B cells and follicular dendritic cells (FDC) and provides a co-stimulatory signal to B cells during the germinal center reaction (2, 6 - 8). CD320 also cooperates with CD44 in promoting the development of B cell lymphomas.
- Shipping Conditions:
- Blue Ice

