RP01814
Recombinant Human Neurogranin/NRGN Protein
Size
£133.00
- SKU:
- RP01814
- Additional Names:
- hng|Neurogranin|NRGN|RC3
- Molecular Weight:
- 45 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Asp2-Asp78
- Formulation:
- Recombinant Human Neurogranin/NRGN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp2-Asp78) of human NRGN/Neurogranin (Accession #) fused with hFc tag at the C-terminus.
- Species:
- Human
- Sequence:
- DCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
- Uniprot:
- Q92686
- Synonyms:
- calmodulin-binding protein;hng;neurogranin;neurogranin (protein kinase C substrate, RC3);protein kinase C substrate;RC3
- Extra Details:
- Neurogranin is as a small protein encoded by the NRGN gene. it is a calmodulin-binding protein expressed primarily in the brain, particularly in dendritic spines, and participating in the protein kinase C signaling pathway. Neurogranin is the main postsynaptic protein regulating the availability of calmodulin, binding to it in the absence of calcium. Phosphorylation by protein kinase C lowers its binding ability. It is a potential biomarker of neurological and mental diseases.
- Shipping Conditions:
- Blue Ice