Recombinant Human RETN Protein

Size

£133.00

SKU:: RP01810
Additional Names:: ADSF|FIZZ3|RENT|RETN1|RSTN|XCP1
Molecular Weight:: 40-45 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser17-Pro108
Formulation:: Recombinant Human RETN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser17-Pro108) of human RETN (Accession #) fused with a hFc, 6xHis tag at the N-terminus.
Species:: Human
Sequence:: SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Uniprot:: Q9HD89
Synonyms:: adipose tissue-specific secretory factor;ADSF;C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1;c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein;cysteine-rich secreted protein A12-alpha-like 2;cysteine-rich secreted protein FIZZ3;FIZZ3;found in inflammatory zone 3;resistin;resistin delta2;RETN1;RSTN;XCP1
Extra Details:: Resistin is an adipocytokine, which has been studied for its role in insulin resistance and recently in inflammation. The RETN and CAP1 polymorphisms and gene expression may be potential biomarkers for breast cancer risk. Resistin (RETN), recently found to be relevant to inflammation and inflammatory disorders.