Recombinant Rat IL-1 beta Protein

Size

£145.00

SKU:: RP01788
Additional Names:: IL-1 beta,IL1B,IL-1BETA,IL1F2,IL-1B Beta,il1b,IL1B|IL-1F2
Molecular Weight:: 18-25 kDa
Purity:: ≥85%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val117-Ser268
Formulation:: Recombinant Rat IL-1 beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val117-Ser268) of rat IL-1 beta (Accession #NP_113700.2) fused with a 6xHis tag at the C-terminus.
Species:: Rat
Sequence:: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Uniprot:: Q5BKB0
Synonyms:: IL-1 beta;IL-1F2;interleukin-1 beta
Extra Details:: Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.