Recombinant Human Angiopoietin-4/ANG-4/ANGPT4(23-503) Protein

Size

£164.05

Was £193.00

SKU:: RP01773
Additional Names:: ANG3|ANG4
Molecular Weight:: 75-100 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln23-Ile503
Formulation:: Recombinant Human Angiopoietin-4/ANG-4/ANGPT4(23-503) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Ile503) of human ANG-4/ANGPT4 (Accession #NP_057069.1) fused with and a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: QQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI
Uniprot:: Q9Y264
Synonyms:: ANG3;ANG4;Angiopoietin-3;angiopoietin-4
Extra Details:: Human Angiopoietin-4 (Ang-4) (1), alternatively named Ang-3 (2), is a secreted glycoprotein belonging to the angiopoietin family. It has the characteristic structural motifs of angiopoietins including the coiled-coiled domain near the amino-terminus and a fibrinogen-like domain at the C-terminus.