RP01772
Recombinant Human PDGF-AA Protein
Size
£145.00
- SKU:
- RP01772
- Additional Names:
- PDGF-A|PDGF1
- Molecular Weight:
- 20 kDa kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ser87-Thr211
- Formulation:
- Recombinant Human PDGF-AA Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser87-Thr211) of human PDGF-AA (Accession #NP_002598.4) fused with no additional amino acid.
- Species:
- Human
- Sequence:
- SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
- Uniprot:
- P04085
- Synonyms:
- PDGF A-chain;PDGF subunit A;PDGF-1;PDGF-A;PDGF1;Platelet-derived growth factor A chain;platelet-derived growth factor A-chain;platelet-derived growth factor alpha chain;platelet-derived growth factor alpha polypeptide;platelet-derived growth factor subunit A
- Extra Details:
- Platelet-derived growth factor alpha (PDGFA) is frequently upregulated in various cancers and thought to function as a key player in the development and progression of tumor growth by regulating aspects of cell proliferation, angiogenesis and metastasis. The human platelet-derived growth factor A chain gene (PDGFA) on chromosome 7p22 encodes an important mitogen. Within PDGFA lies a complex minisatellite structure that results in partial duplications of exon 4 and the IVS4 splice donor site.
- Shipping Conditions:
- Blue Ice