Recombinant Human MMP-7 Protein

Size

£163.00

SKU:: RP01770LQ
Additional Names:: MMP7, MPSL1, PUMP1,Matrilysin, Matrix metalloproteinase-7, MMP-7
Molecular Weight:: 35-40 kDa
Purity:: ≥95%
Storage Conditions:: -70[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Tyr95-Lys267
Formulation:: Recombinant Human MMP-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr97-Lys267) of human MMP7 (Accession #NP_002414.1) fused with hFc tag at the C-terminus.
Species:: Human
Sequence:: YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Uniprot:: P09237
Synonyms:: matrilysin;matrin;matrix metallopeptidase 7 (matrilysin, uterine);matrix metalloproteinase 7 (matrilysin, uterine);matrix metalloproteinase-7;MMP-7;MPSL1;PUMP-1;pump-1 protease;uterine matrilysin;uterine metalloproteinase
Extra Details:: Matrix metalloproteinase-7 (MMP-7) also known as neutrophil collagenase and CLG1, is a member of matrix metalloproteinases (MMPs) family, which degrade components of the extracellular matrix (ECM) and play essential roles in various physiological processes as well as pathological processes. MMP-7 may affect the metastatic behavior of breast cancer cells through protection against lymph node metastasis, underlining the importance of anti-target identification in drug development. MMP-7 in the tumor may have a protective effect against lymph node metastasis.

Shipping Conditions:: Dry Ice