RP01763
Recombinant Human PDGF-BB Protein
Size
£163.00
- SKU:
- RP01763
- Additional Names:
- c-sis|IBGC5|PDGF subunit B|PDGF-2|PDGF-BB|PDGF2|PDGFB|SIS|SSV
- Molecular Weight:
- 10-17 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ser82-Thr190
- Formulation:
- Recombinant Human PDGF-BB Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ser82-Thr190) of human PDGF-BB (Accession #NP_002599.1) fused with a additional amino acid free.
- Species:
- Human
- Sequence:
- SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
- Uniprot:
- P01127
- Synonyms:
- becaplermin;c-sis;epididymis secretory sperm binding protein;IBGC5;PDGF subunit B;PDGF-2;PDGF, B chain;PDGF2;platelet-derived growth factor 2;platelet-derived growth factor B chain;Platelet-derived growth factor beta polypeptide;platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog);platelet-derived growth factor subunit B;platelet-derived growth factor, beta polypeptide (oncogene SIS);proto-oncogene c-Sis;SIS;SSV
- Extra Details:
- Platelet-derived growth factor-B (PDGFB) is necessary for normal cardiovascular development. The administration of PDGFB alone normalized tumor vasculature by increasing periendothelial coverage and vascular functionality. Interestingly, this effect exerted by PDGFB was also observed in the presence of DAPT. So PDGFB is able to improve tumor vascularity and allows the anticancer action of DAPT in the tumor.
- Shipping Conditions:
- Blue Ice