Recombinant Rat IL-21 Protein

Size

£163.00

SKU:: RP01756
Additional Names:: CVID11|IL-21|Za11
Molecular Weight:: 15-35 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: His18-Ser146
Formulation:: Recombinant Rat IL-21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His18-Ser146) of rat IL-21 (Accession #NP_001102413.1) fused with a 6xHis tag at the C-terminus.
Species:: Rat
Sequence:: HKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS
Uniprot:: A3QPB9
Synonyms:: IL-21;interleukin-21
Extra Details:: IL21 belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation, and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems. IL21 is expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes. It may promote the transition between innate and adaptive immunity. IL-21 has been tried as a therapy for alleviating allergic responses. It can significantly decrease pro-inflammatory cytokines produced by T cells in addition to decreasing IgE levels in a mouse model for rhinitis (nasal passage inflammation).

Shipping Conditions:: Blue Ice