RP01731
Recombinant human SECTM1 Protein
Size
£133.00
- SKU:
- RP01731
- Additional Names:
- K12|SECTM|SECTM1
- Molecular Weight:
- 20-25 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Gln29-Gly145
- Formulation:
- Recombinant human SECTM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln29-Gly145) of human SECTM1 (Accession #NP_002995.1.) fused with and a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG
- Uniprot:
- Q8WVN6
- Synonyms:
- K12;Protein K-12;secreted and transmembrane protein 1;SECTM;type 1a transmembrane protein
- Extra Details:
- Secreted and transmembrane 1 (SECTM1), also known as K12, is a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein of SECTM family. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
- Shipping Conditions:
- Blue Ice