Recombinant Rat IL-7 Protein

Size

£145.00

SKU:: RP01721
Additional Names:: IL-7,Interleukin-7; IL7
Molecular Weight:: 15-35 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asp26-Ile154
Formulation:: Recombinant Rat IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp26-Ile154) of rat IL-7 (Accession #NP_037242.2) fused with and a 6xHis tag at the C-terminus.
Species:: Rat
Sequence:: DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI
Uniprot:: Q91Y32
Synonyms:: IL-7;interleukin-7
Extra Details:: IL7, also known as interleukin 7, is a hematopoietic growth factor that belongs to the IL-7/IL-9 family. It is secreted by stromal cells in the bone marrow and thymus. IL7 stimulates the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. It is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCR?) during early T cell development. IL7 can be produced locally by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes.