RP01721
Recombinant Rat IL-7 Protein

Size
£145.00
- SKU:
- RP01721
- Additional Names:
- IL-7,Interleukin-7; IL7
- Molecular Weight:
- 15-35 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Asp26-Ile154
- Formulation:
- Recombinant Rat IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp26-Ile154) of rat IL-7 (Accession #NP_037242.2) fused with and a 6xHis tag at the C-terminus.
- Species:
- Rat
- Sequence:
- DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTKEAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIKEQKKNDPCFLKRLLREIKTCWNKILNSSI
- Uniprot:
- Q91Y32
- Synonyms:
- IL-7;interleukin-7
- Extra Details:
- IL7, also known as interleukin 7, is a hematopoietic growth factor that belongs to the IL-7/IL-9 family. It is secreted by stromal cells in the bone marrow and thymus. IL7 stimulates the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. It is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCR?) during early T cell development. IL7 can be produced locally by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes.
- Shipping Conditions:
- Blue Ice



