Recombinant Human Erythropoietin/EPO Protein

Size

£163.00

SKU:: RP01690
Additional Names:: DBAL|ECYT5|EP|MVCD2; EPO; Erythropoietin
Molecular Weight:: Approximately 35 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala28-Arg193
Formulation:: Recombinant Human Erythropoietin/EPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala28-Arg193) of human Erythropoietin/EPO (Accession #NP_000790.2) fused with no additional amino acid.
Species:: Human
Sequence:: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Uniprot:: P01588
Synonyms:: DBAL;ECYT5;EP;epoetin;erythropoietin;MVCD2
Extra Details:: Erythropoietin (EPO) is the major glycoprotein hormone regulator of mammalian erythropoiesis, and is produced by kidney and liver in an oxygen-dependent manner. The biological effects of EPO are mediated by the specific erythropoietin receptor (EPOR/EPO Receptor) on bone marrow erythroblasts, which transmits signals important for both proliferation and differentiation along the erythroid lineage. EPOR protein is a type a..., single-transmembrane cytokine receptor, and belongs to the homodimerizing subclass which functions as ligand-induced or ligand-stabilized homodimers. EPOR signaling prevents neuronal death and ischemic injury. Recent studies have shown that EPO and EPOR protein may be involved in carcinogenesis, angiogenesis, and invasion.

Shipping Conditions:: Blue Ice