Recombinant Human IL-6 Protein

Size

£127.00

SKU:: RP01688
Additional Names:: BSF-2|BSF2|CDF|HGF|HSF|IFN-beta-2|IFNB2|IL-6
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val30-Met212
Formulation:: Active Recombinant Human IL6 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val30-Met212) of human IL6 (Accession #NP_000591.1) fused with no additional amino acid.
Species:: Human
Sequence:: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Uniprot:: P05231
Synonyms:: B-cell differentiation factor;B-cell stimulatory factor 2;BSF-2;BSF2;CDF;CTL differentiation factor;HGF;HSF;hybridoma growth factor;IFN-beta-2;IFNB2;IL-6;interferon beta-2;interleukin BSF-2;interleukin-6
Extra Details:: Interleukin-6 is a multifunctional A Alpha-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions.It is secreted by T cells, macrophages , monocytes, fibroblasts,endothelial cells,et.al. to stimulate immune response to trauma, especially burns or other tissue damage leading to inflammation.Interleukin 6 has been shown to interact with interleukin-6 receptor and glycoprotein. IL-6 is relevant to many disease processes such as diabetes,atherosclerosis, depression,Alzheimer's Disease,systemic,lupus erythematosus,prostate cancer and rheumatoid arthritis.

Shipping Conditions:: Blue Ice