RP01677LQ
Recombinant Human S100-A10 Protein
Size
£133.00
- SKU:
- RP01677LQ
- Additional Names:
- 42C|ANX2L|ANX2LG; S100A10|Ca[1]|CAL1L|CLP11|GP11|p10|P11
- Molecular Weight:
- 12-15 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Lys97
- Formulation:
- Recombinant Human S100-A10 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Lys97) of human S100A10 (Accession #NP_002957.1) fused with and a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
- Uniprot:
- P60903
- Synonyms:
- 42C;annexin II ligand, calpactin I, light polypeptide;annexin II tetramer (AIIt) p11 subunit;ANX2L;ANX2LG;Ca[1];CAL1L;calpactin I light chain;calpactin-1 light chain;cellular ligand of annexin II;CLP11;GP11;p10;p10 protein;P11;protein S100-A10;S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11));S100 calcium-binding protein A10
- Extra Details:
- S100A10 functions as a linker tethering certain transmembrane proteins to annexin A2 thereby assisting their traffic to the plasma membrane and/or their firm anchorage at certain membrane sites.
- Shipping Conditions:
- Dry Ice