Recombinant Mouse IL-15 Protein

Size

£193.00

SKU:: RP01676
Additional Names:: Il15, Interleukin-15, IL-15
Molecular Weight:: 14 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Asn49-Ser162
Formulation:: Recombinant Mouse IL-15 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asn49-Ser162) of mouse IL-15 (Accession #NP_001241676.1) fused with and a 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
Uniprot:: P48346
Synonyms:: AI503618;IL-15;interleukin-15
Extra Details:: Interleukin 15 (IL-15 ) is a cytokine that regulates T and natural killer cell activation and proliferation. IL-15 induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. In mouse, studies suggest that IL-15 may increase the expression of apoptosis inhibitor Bcl-xL, possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. IL-15 plays an important role in the growth and differentiation of T and B lymphocytes, natural killer cells, macrophages, and monocytes as well as activation of a number of important intracellular signaling molecules.