RP01676
Recombinant Mouse IL-15 Protein

Size
£193.00
- SKU:
- RP01676
- Additional Names:
- Il15, Interleukin-15, IL-15
- Molecular Weight:
- 14 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Asn49-Ser162
- Formulation:
- Recombinant Mouse IL-15 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asn49-Ser162) of mouse IL-15 (Accession #NP_001241676.1) fused with and a 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS
- Uniprot:
- P48346
- Synonyms:
- AI503618;IL-15;interleukin-15
- Extra Details:
- Interleukin 15 (IL-15 ) is a cytokine that regulates T and natural killer cell activation and proliferation. IL-15 induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. In mouse, studies suggest that IL-15 may increase the expression of apoptosis inhibitor Bcl-xL, possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. IL-15 plays an important role in the growth and differentiation of T and B lymphocytes, natural killer cells, macrophages, and monocytes as well as activation of a number of important intracellular signaling molecules.
- Shipping Conditions:
- Blue Ice





