RP01674
Recombinant Mouse B7-H3/CD276 Protein
Size
£127.00
- SKU:
- RP01674
- Additional Names:
- 6030411F23Rik; CD276|B7h3|B7RP-2
- Molecular Weight:
- 65-75 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Val 29 - Phe 244
- Formulation:
- Recombinant Mouse B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val 29 - Phe 244) of mouse CD276 (Accession #NP_598744.1) fused with and a hFc tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTF
- Uniprot:
- Q8VE98
- Synonyms:
- 6030411F23Rik;AU016588;B7 homolog 3;B7-H3;B7h3;B7RP;B7RP-2;CD276 antigen;costimulatory molecule
- Extra Details:
- B7-H3 is a member of the B7 family of immune regulatory ligands that is thought to attenuate peripheral immune responses through co-inhibition. It plays an important role in adaptive immune responses, and was shown to either promote or inhibit T-cell responses in various experimental systems. B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. B7-H3 is a novel protein structurally related to the B7 family of ligands by the presence of a single set of immunoglobulin-V-like and immunoglobulin-C-like (VC) domains. Previous studies have correlated its overexpression with poor prognosis and decreased tumor-infiltrating lymphocytes in various carcinomas including uterine endometrioid carcinomas, and mounting evidence supports an immuno-inhibitory role in ovarian cancer prognosis. Recently, B7-H3 expression has been reported in several human cancers indicating an additional function of B7-H3 as a regulator of antitumor immunity.
- Shipping Conditions:
- Blue Ice