RP01672
Recombinant Human IHH Protein
Size
£163.00
- SKU:
- RP01672
- Additional Names:
- BDA1|HHG2; IHH
- Molecular Weight:
- 20 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Cys28-Gly202(Cys28Ile-Ile) (N-Met)
- Formulation:
- Recombinant Human IHH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys28-Gly202(Cys28Ile-Ile) (N-Met) ) of human IHH (Accession #NP_002172.2) fused with no additional amino acid.
- Species:
- Human
- Sequence:
- CGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG
- Uniprot:
- Q14623
- Synonyms:
- BDA1;HHG-2;HHG2;Indian hedgehog homolog;indian hedgehog protein
- Extra Details:
- By Similarity2 Publications Indian hedgehog protein N-product The dually lipidated indian hedgehog protein N-product is a morphogen which is essential for a variety of patterning events during development.
- Shipping Conditions:
- Blue Ice