Recombinant Rat IL-9 Protein

Size

£145.00

SKU:: RP01664
Additional Names:: IL9
Molecular Weight:: 30-40 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln19-Ala144
Formulation:: Recombinant Rat IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Ala144) of rat IL-9 (Accession #NP_001099217.1) fused with and a 6xHis tag at the C-terminus.
Species:: Rat
Sequence:: QRCSTSWGIQHTSYLIENLKDDPSSKCSCSANVTSCLCLPIPSDDCTTPCFQEGMSQVTNATQQSKFSPFFFRVKRIVETLKSNKCQFFSCEKPCNQTTAGNTVSFLKSLLKTFQKTEVQVQRSRA
Uniprot:: D4A8I9
Synonyms:: interleukin-9
Extra Details:: IL-9 is a pleiotropic cytokine that influences various distinct functions of different target cells such as T cells, B cells, mast cells and airway epithelial cells by activating STAT1, STAT3 and STAT5. Because of its pleiotropic functions, IL-9 has been demonstrated to be involved in several diseases, such as cancer, autoimmunity and other pathogen-mediated immune-regulated diseases.