Recombinant Mouse IL-12B/IL-12 p40 Protein

Size

£145.00

SKU:: RP01661
Additional Names:: Il-12b|Il-12p40|IL12B|Il12p40|p40
Molecular Weight:: 45-55 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Met23-Ser335
Formulation:: Recombinant Mouse IL-12B/IL-12 p40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met23-Ser335) of mouse IL-12B (Accession #NP_001152896.1) fused with and a 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Uniprot:: P43432
Synonyms:: CLMF p40;cytotoxic lymphocyte maturation factor 40 kDa subunit;Il-1;Il-12;IL-12 p40 subunit;IL-12 subunit p40;Il-12b;Il-12p40;IL-23 subunit p40;Il12p40;interleukin-12 p40 subunit;interleukin-12 subunit beta;p40
Extra Details:: Subunit beta of interleukin 12 (also known as natural killer cell stimulatory factor 2, or cytotoxic lymphocyte maturation factor 2, p40) (IL12B) is a subunit of human interleukin 12. IL12B/IL-12B is a cytokine that acts on T and natural killer cells and has a broad array of biological activities.