Recombinant Human/Mouse FGF-8B Protein

Size

£145.00

SKU:: RP01659
Additional Names:: AIGF|FGF-8|FGF8B|HBGF-8|HH6|KAL6
Molecular Weight:: 35-45kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gln23-Arg215
Formulation:: Recombinant Human/Mouse FGF-8B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln23-Arg215) of human FGF-8B (Accession #NP_006110.1) fused with and a 6xHis tag at the C-terminus.
Species:: Human, Mouse
Sequence:: QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Uniprot:: P55075-3
Synonyms:: AIGF;androgen-induced growth factor;FGF-8;fibroblast growth factor 8;fibroblast growth factor 8 (androgen-induced);HBGF-8;heparin-binding growth factor 8;HH6;KAL6
Extra Details:: In mammalian embryos, transient Fgf8 expression defines the developing isthmic region, lying between the midbrain and the first rhombomere, but there has been uncertainty about the existence of a distinct isthmic segment in postnatal mammals. Retinoic acid (RA) directly represses Fgf8 through a RARE-mediated mechanism that promotes repressive chromatin, thus providing valuable insight into the mechanism of RA-FGF antagonism during progenitor cell differentiation. Fgf8 encodes a key signaling factor, and its precise regulation is essential for embryo patterning.

Shipping Conditions:: Blue Ice