RP01643
Recombinant Human CD9 Protein

Size
£163.00
- SKU:
- RP01643
- Additional Names:
- BTCC-1|CD9|DRAP-27|MIC3|MRP-1|TSPAN-29|TSPAN29
- Molecular Weight:
- 10-15 kDa
- Purity:
- ≥90%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ser112-Ile195
- Formulation:
- Recombinant Human CD9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser112-Ile195) of human CD9 (Accession #NP_001760.1) fused with and a 6xHis tag at the C-terminus.
- Species:
- Human
- Sequence:
- SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
- Uniprot:
- P21926
- Synonyms:
- 5H9 antigen;antigen CD9;BA-2/p24 antigen;BTCC-1;CD9 antigen;CD9 antigen (p24);cell growth-inhibiting gene 2 protein;DRAP-27;leukocyte antigen MIC3;MIC3;motility related protein-1;Motility-related protein;MRP-1;p24;tetraspanin-29;TSPAN-29;TSPAN29
- Extra Details:
- CD9 is a member of the transmembrane 4 superfamily, which is also known as the tetraspanin family. CD9 is a cell surface glycoprotein with 4 hydrophobic domains that are described as complex with integrins and other transmembrane 4 superfamily members. It is found expressed on the surface of the exosomes. The protein takes part in cellular signal transduction events and thus play a role in the regulation of cell development and activation, growth and motility. Besides, CD9 seems to be a key role in the egg-sperm fusion during the mammalian fertilization processes. CD9 is found on the membrane of the oocytes and also appears to intervene in maintaining the normal shape of oocyte microvilli.
- Shipping Conditions:
- Blue Ice

