Recombinant Human IL-22 Protein

Size

£145.00

SKU:: RP01616
Additional Names:: Cytokine Zcyto18|IL-22|IL-D110|IL-TIF|Interleukin-22|TIFa|TIFIL-23|ZCYTO18,IL22
Molecular Weight:: 17-35 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ala34-Ile179
Formulation:: Recombinant Human IL-22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala34-Ile179) of human IL-22 (Accession #NP_065386.1) fused with and a 6xHis tag at the C-terminus.
Species:: Human
Sequence:: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Uniprot:: Q9GZX6
Synonyms:: cytokine Zcyto18;IL-10-related T-cell-derived inducible factor;IL-10-related T-cell-derived-inducible factor;IL-21;IL-22;IL-D110;IL-TIF;ILTIF;interleukin-22;TIFa;TIFIL-23;zcyto18
Extra Details:: The cytokine interleukin-22 (IL-22) is a critical regulator of epithelial homeostasis. It has been implicated in multiple aspects of epithelial barrier function, including regulation of epithelial cell growth and permeability, production of mucus and antimicrobial proteins (AMPs), and complement production.