Recombinant Monkeypox virus D6L Protein

Size

£127.00

SKU:: RP01606
Additional Names:: COP-009|D6L|IL-18 binding protein
Molecular Weight:: 15-20 kDa
Species Reactivity:: Virus
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val21-Lys126
Formulation:: Recombinant Monkeypox virus D6L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val21-Lys126) of monkeypox virus D6L (Accession #Q5QC89) fused with a 6xHis tag at the C-terminus.
Species:: Virus
Sequence:: VETKCPNLAIVTSSGEFHCSGCVERMPGFSYMYWLANDMKSDEDTKFIEHLGDGIKEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLITLDGVSKKNIWLK
Uniprot:: Q5QC89
Synonyms:: Interleukin-18-binding protein;MPXV_gp007