RP01596
Recombinant Mouse IL-13 Protein
Size
£163.00
- SKU:
- RP01596
- Additional Names:
- Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13,IL13,Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13,IL13
- Molecular Weight:
- 15-35 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ser26-Phe131
- Formulation:
- Recombinant Mouse IL-13 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser26-Phe131) of mouse IL-13 (Accession #NP_032381.1) fused with and a 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
- Uniprot:
- P20109
- Synonyms:
- Il-;Il-13;interleukin-13;T-cell activation protein P600
- Extra Details:
- Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13RA Alpha1 with low affinity and triggers association of IL4R A Alpha , generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13RA Alpha2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.
- Shipping Conditions:
- Blue Ice