RP01594
Recombinant Monkeypox virus B16R Protein

Size
£127.00
- SKU:
- RP01594
- Additional Names:
- B16R|COP-167|IFN-alpha/beta receptor glycoprotein
- Molecular Weight:
- 50-65 kDa
- Species Reactivity:
- Virus
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ile25-Glu352
- Formulation:
- Recombinant Monkeypox virus B16R Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile25-Glu352) of monkeypox virus B16R (Accession #Q5IXK2) fused with a 6xHis tag at the C-terminus.
- Species:
- Virus
- Sequence:
- IDIENEITEFFNKMRDTLPAKDSKWLNPVCMFGGTMNDMAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGVVRSHVWKPSSCIPKTYELGTYDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDFKYSQAGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCSAVSTSLFVDDVLIEWKNPSGWIIGLDFGVYSILTSRGGITEATLYFENVTEEYIGNTYTCRGHNYYFDKTLTTTVVLE
- Uniprot:
- Q5IXK2
- Synonyms:
- IFN-alpha/beta-receptor-like secreted glycoprotein;MPXV_gp170
- Shipping Conditions:
- Blue Ice

