Recombinant Mouse Asparaginyl endopeptidase/Legumain/LGMN Protein

Size

£145.00

SKU:: RP01579
Additional Names:: AEP, Prsc1,LGMN
Molecular Weight:: 60 kda
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Val18-Tyr435
Formulation:: Recombinant Mouse Asparaginyl endopeptidase/Legumain/LGMN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val18-Tyr435) of mouse Asparaginyl endopeptidase/Legumain (Accession #NP_035305.1) fused with a 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHY
Uniprot:: O89017
Synonyms:: A;AEP;AI746452;asparaginyl endopeptidase;AU022324;legumain;Pr;preprolegumain;Protease, cysteine 1;protease, cysteine, 1;Prsc1
Extra Details:: The Mammalian Legumain, also known as LGMN, also called asparaginyl endopeptidase (AEP), is a cysteine protease belonging to peptidase family C13 with strict specificity for hydrolysis of asparaginyl bonds. Has a strict specificity for hydrolysis of asparaginyl bonds. Can also cleave aspartyl bonds slowly, especially under acidic conditions. May be involved in the processing of proteins for MHC class II antigen presentation in the lysosomal/endosomal system. Required for normal lysosomal protein degradation in renal proximal tubules. Required for normal degradation of internalized EGFR. Plays a role in the regulation of cell proliferation via its role in EGFR degradation.

Shipping Conditions:: Blue Ice