RP01564
Recombinant Human S100-A4 Protein

Size
£127.00
- SKU:
- RP01564
- Additional Names:
- 18A2,42A,CAPL,FSP1,MTS1,P9KA,PEL98,S100A4, 18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98, protein S100-A4
- Molecular Weight:
- 11-15 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Ala2-Lys101
- Formulation:
- Recombinant Human S100-A4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Lys101) of human S100-A4 (Accession #NP_002952.1) fused with no additional amino acid.
- Species:
- Human
- Sequence:
- ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
- Uniprot:
- P26447
- Synonyms:
- 18A2;42A;calcium placental protein;Calvasculin;CAPL;fibroblast-specific protein-1;FSP1;leukemia multidrug resistance associated protein;malignant transformation suppression 1;Metastasin;metastasin 1;MTS1;murine placental homolog;P9KA;PEL98;placental calcium-binding protein;protein Mts1;protein S100-A4;S100 calcium-binding protein A4;S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
- Extra Details:
- S100A4 belongs to the family of small calcium-binding S100 proteins containing two EF-hand calcium-binding motifs. In humans at least 20 S100 family members that are distributed tissue specifically have been identified, and are involved in a number of cellular processes as transducers of calcium signal. S100A4 is a symmetric homodimer, and undergoes a relatively large conformational change upon the typical EF-hand binding calcium, which is necessary for S100A4 to interact with its protein targets and generate biological effects. It can bind the already known targets p53, F-actin, liprin B Beta, myosin heavy chain II, and prevent their phosphorylation and multimerization. It has been demonstrated that S100A4 is directly involved in tumor metastasis including cell motility, invasion, apoptosis, angiogenesis and differentiation, and appears to be a metastasis factor and a molecular marker for clinical prognosis. Multiple alternatively spliced variants encoding the same protein have been identified.
- Shipping Conditions:
- Blue Ice

