RP01543
Recombinant Monkeypox virus A29 Protein

Size
£175.00
- SKU:
- RP01543
- Additional Names:
- A29L,A29,A29L,A29L,A29,A29L
- Molecular Weight:
- Approximately 15 kDa
- Species Reactivity:
- Virus
- Purity:
- ≥85%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Met1-Glu110
- Formulation:
- Recombinant Monkeypox virus A29 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu110) of A29 (Accession #URK20577.1) fused with a 6xHis tag at the C-terminus.
- Species:
- Virus
- Sequence:
- MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRHPYE
- Uniprot:
- Q77HM6
- Synonyms:
- IMV surface fusion protein;MPXV_gp133
- Shipping Conditions:
- Blue Ice

