RP01537
Recombinant Mouse CD200R1 Protein

Size
£127.00
- SKU:
- RP01537
- Additional Names:
- CD200R,CRTR2,MOX2R,OX2R,CD200R1
- Molecular Weight:
- 75-100 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Thr26-Pro238
- Formulation:
- Recombinant Mouse CD200R1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr26-Pro238) of mouse CD200R1 (Accession #NP_067300.1) fused with Fc, Avi tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP
- Uniprot:
- Q9ES57
- Synonyms:
- antigen identified by monoclonal antibody MRC OX-2 receptor;CD200;CD200 cell surface glycoprotein receptor;CD200R;cell surface glycoprotein CD200 receptor 1;cell surface glycoprotein OX2 receptor 1;Mox;Mox2r;Orexin receptor 2;OX;OX2R
- Extra Details:
- The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. Cell surface glycoprotein CD200 receptor 1 (CD200R1) is an isoform of CD200 receptors that is expressed on cells of the myeloid lineage. CD200R1 is a receptor for the OX-2 membrane glycoprotein. The receptor-substrate interaction may serve as a myeloid downregulatory signal.
- Shipping Conditions:
- Blue Ice



