RP01520
Recombinant Human MITF Protein

Size
£127.00
- SKU:
- RP01520
- Additional Names:
- CMM8, COMMAD, MI, WS2, WS2A, bHLHe32,MITF,COMMAD,MI,WS2,WS2A,bHLHe32
- Molecular Weight:
- 45-70 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- His402-Cys526
- Formulation:
- Recombinant Human MITF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His402-Cys526) of human MITF (Accession #NP_000239.1) fused with a raFc tag at the N-terminus.
- Species:
- Human
- Sequence:
- HGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC
- Uniprot:
- O75030
- Synonyms:
- bHLHe32;class E basic helix-loop-helix protein 32;CMM8;COMMAD;melanogenesis associated transcription factor;MI;microphtalmia-associated transcription factor;microphthalmia-associated transcription factor;MITF-A;WS2;WS2A
- Extra Details:
- Microphthalmia-associated transcription factor (MITF) is a member of the basic helix-loop-helix leucine zipper (bHLH-Zip) family and functions as the master regulator of the melanocytic lineage.MITF (Microphthalmia-associated transcription factor) is a lineage-specific transcription factor that plays a critical role in melanocyte homeostasis and whose deregulation has been shown to contribute to melanoma disease. Microphthalmia-associated transcription factor (MITF) is expressed in melanomas and has a critical role in melanocyte development and transformation. Because inhibition of MITF inhibits cell growth in melanoma, MITF is a potential therapeutic target molecule. Microphthalmia-associated transcription factor (MITF) regulates the transcription of its target genes by binding to their promoters. Microphthalmia-associated transcription factor (MITF) is a key regulator of differentiation of melanocytes and retinal pigment epithelial cells, but it also has functions in non-pigment cells.
- Shipping Conditions:
- Blue Ice

