Recombinant Mouse TIGIT Protein

Size

£133.00

SKU:: RP01516LQ
Additional Names:: TIGIT,VSIG9,VSTM3,TIGIT,TIGIT,VSIG9,VSTM3,TIGIT
Molecular Weight:: 45-60 kDa
Purity:: ≥90%
Storage Conditions:: -70[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly26-Gly141
Formulation:: Recombinant Human TIGIT Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly26-Gly141) of human TIGIT (Accession #NP_001139797.1) fused with a mFc tag at the C-terminus.
Species:: Mouse
Sequence:: GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG
Uniprot:: P86176
Synonyms:: T-cell immunoreceptor with Ig and ITIM domains;V-set and transmembrane domain containing 3;V-set and transmembrane domain-containing protein 3;Vst;Vstm3
Extra Details:: TIGIT, also known as V-set and transmembrane domain-containing protein 3 (VSTM3) or V-set and immunoglobulin domain-containing protein 9 (VSIG9) is a new surface protein containing an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM). TIGIT is expressed on regulatory, memory, activated T cells and NK cells. It binds PVR with high affinity, and PVRL2 with lower affinity, but not PVRL3. Knockdown of TIGIT with siRNA in human memory T cells did not affect T cell responses, however, TIGIT inhibits NK cytotoxicity directly through its ITIM. TIGIT suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells. The binding of PVR to TIGIT on human dendritic cells enhanced the production of IL-1 and diminished the production of IL-12p4. Also, TIGIT counter inhibits the NK-mediated killing of tumor cells and protects normal cells from NK-mediated cytotoxicity thus providing an "alternative self" mechanism for MHC class I inhibition.

Shipping Conditions:: Dry Ice