RP01515
Recombinant Mouse Ephrin-A2/EFNA2 Protein
Size
£127.00
- SKU:
- RP01515
- Additional Names:
- Elf1,Epl6,CEK7L,Eplg6,Lerk6,EFNA2
- Molecular Weight:
- 25-30 kDa
- Purity:
- ≥95%
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Immunogen:
- Arg21-Asn184
- Formulation:
- Recombinant Mouse Ephrin-A2/EFNA2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg21-Asn184) of mouse Ephrin-A2 (Accession #NP_031935.3) fused with a 6xHis tag at the C-terminus.
- Species:
- Mouse
- Sequence:
- RNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPIFTSN
- Uniprot:
- P52801
- Synonyms:
- Cek7-;CEK7-ligand;CEK7L;Elf-;ELF-1;Elf1;Ep;EPH related receptor tyrosine kinase ligand 6;EPH-related receptor tyrosine kinase ligand 6;Ephr;ephrin A6;ephrin-A2;Epl6;Eplg6;LERK;Lerk6
- Extra Details:
- Ephrin-A2 also known as EFNA2 or EPH-related receptor tyrosine kinase ligand 6, is a member of the ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Ephrin-A2 and their Eph family of receptor tyrosine kinases are expressed by cells of the SVZ. Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. Ephrin-A2 regulates the position-specific affinity of limb mesenchyme and is involved in cartilage pattern formation in the limb.
- Shipping Conditions:
- Blue Ice