Recombinant Mouse Fc gamma RIIB/FCGR2B/CD32b Protein

Size

£133.00

SKU:: RP01501
Additional Names:: CD32,CD32B,FCG2,FCGR2,IGFR2,Fcgr2b
Molecular Weight:: 30-40 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Thr30-Pro210
Formulation:: Recombinant Mouse Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr30-Pro210) of mouse Fc gamma RIIB/CD32b (Accession #NP_034317.1) fused with a 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLP
Uniprot:: P08101
Synonyms:: AI528646;CD32;F630109E10Rik;fc gamma receptor IIB;Fc gamma RIIB;fc-gamma RII;Fc-gamma-RII;fc-gamma-RIIB;Fc[g];Fc[g]RII;Fcg;Fcgamm;FcgammaRIIB;Fcgr;Fcgr2;Fcgr2a;FcgRII;Fcr-;Fcr-2;Fcr-3;fcRII;igG Fc receptor II beta;low affinity immunoglobulin gamma Fc region receptor II;low affinity immunoglobulin gamma Fc region receptor II-b;Ly-1;Ly-17;Ly-m2;Ly-m20;LyM-;LyM-1;lymphocyte antigen 17
Extra Details:: The protein is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells.