Recombinant Mouse CD5 Protein

Size

£133.00

SKU:: RP01500
Additional Names:: LEU1,T1,CD5
Molecular Weight:: 50-60 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Ser25-Pro371
Formulation:: Recombinant Mouse CD5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser25-Pro371) of mouse CD5/Lyt1 (Accession #NP_031676.3) fused with a 6xHis tag at the C-terminus.
Species:: Mouse
Sequence:: SGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNP
Uniprot:: P13379
Synonyms:: Ly;Ly-;Ly-1;Ly-12;Ly-A;lymphocyte antigen 1;Lyt-;Lyt-1;T-cell surface glycoprotein CD5
Extra Details:: CD5, also known as Leu-1, Ly-1, and T1, is a 67 kDa transmembrane glycoprotein in the scavenger receptor superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation.

Shipping Conditions:: Blue Ice