Recombinant Human LILRA1/LIR-6/CD85i Protein

Size

£145.00

SKU:: RP01457
Additional Names:: LILRA1,CD85I,LIR-6,LIR6
Molecular Weight:: 70-90 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Pro17-Asn461
Formulation:: Recombinant Human LILRA1/LIR-6/CD85i Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro17-Asn461) of human LILRA1/CD85i/LIR-6 (Accession #NP_006854.1) fused with a 6xHis, Avi tag at the C-terminus.
Species:: Human
Sequence:: PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN
Uniprot:: O75019
Synonyms:: CD85 antigen-like family member I;CD85I;leucocyte Ig-like receptor A1;leukocyte immunoglobulin-like receptor 6;leukocyte immunoglobulin-like receptor subfamily A member 1;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1;LIR-6;LIR6
Extra Details:: Leukocyte immunoglobulin-like receptors (LILRs) are inhibitory, stimulatory or soluble receptors encoded within the leukocyte receptor complex. Some LILRs are extensively polymorphic, and exhibit evidence for balancing selection and association with disease susceptibility. LILRA1 (LIR-6) can recognize MHC (major histocompatibility complex) class I or class I-like molecules, and high levels of sequence similarity among LILRA1, LILRA2 (ILT1), LILRA3 (ILT6) and LILRB1/B2.

Shipping Conditions:: Blue Ice