Recombinant Human LILRA6/ILT-8/CD85b Protein

Size

£133.00

SKU:: RP01453
Additional Names:: ILT5,ILT8,CD85b,ILT-8,LILRB3,LILRB6,LILRA6
Molecular Weight:: 65-75 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly24-Asn447
Formulation:: Recombinant Human LILRA6/ILT-8/CD85b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Asn447) of human LILRA6/CD85b/ILT8 (Accession #CCDS42610.1) fused with a 6xHis, Avi tag at the C-terminus.
Species:: Human
Sequence:: GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN
Uniprot:: Q6PI73
Synonyms:: CD85b;ILT-8;ILT5;ILT8;immunoglobulin-like transcript 5;immunoglobulin-like transcript 8;leucocyte Ig-like receptor A6;leukocyte Ig-like receptor;leukocyte immunoglobulin like receptor B3;leukocyte immunoglobulin-like receptor subfamily A member 6;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 6;LILRB3;LILRB6
Extra Details:: The LILRs are a family of receptors that regulate the activities of myelomonocytic cells. LILRB3 and LILRA6 represent a pair of inhibitory/activating receptors with identical extracellular domains and unknown ligands. LILRB3 (ILT5) and LILRA6 (ILT8) are highly polymorphic receptors with similar extracellular domains. LILRA6 can signal through association with an activating adaptor molecule, FcRG Gamma, which bears a cytoplasmic tail with an immunoreceptor tyrosine-based activation motif. Analysis of mRNA expression in the major fractions of PBMCs showed that LILRA6 is primarily expressed in monocytes, and its expression level correlates with copy number of the gene.

Shipping Conditions:: Blue Ice