Recombinant Human NKAT-6/KIR2DL2/CD158b1 Protein

Size

£133.00

SKU:: RP01452
Additional Names:: KIR2DL2,CD158B1,CD158b,NKAT-6,NKAT6,p58.2
Molecular Weight:: 40-55 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: His22-His245
Formulation:: Recombinant Human NKAT-6/KIR2DL2/CD158b1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL2 (Accession #NP_055034.2) fused with a 6xHis, Avi tag at the C-terminus.
Species:: Human
Sequence:: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH
Uniprot:: P43627
Synonyms:: CD158 antigen-like family member B1;CD158b;CD158B1;killer cell immunoglobulin-like receptor 2DL2;killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 2;MHC class I NK cell receptor;natural killer-associated transcript 6;NKAT-6;NKAT6;p58 natural killer cell receptor clone CL-43;p58 NK receptor CL-43;p58.2
Extra Details:: KIR2DL2 (2DL2, formerly NKAT6, designated CD158b) is a 348 amino acid (aa) type I transmembrane glycoprotein that belongs to the human killer cell Ig?like receptor (KIR) family. KIRs are expressed on human CD56dim NK cells and T cell subsets, and regulate effector functions in the innate immune system.KIR2DL2 is receptor on natural killer (NK) cells for HLA-Cw1, 3, 7, and 8 allotypes. Inhibits the activity of NK cells thus preventing cell lysis.

Shipping Conditions:: Blue Ice