Recombinant Human LILRB3/ILT-5/CD85a Protein

Size

£133.00

SKU:: RP01436
Additional Names:: LILRB3,CD85A,HL9,ILT-5,ILT5,LILRA6,LIR-3,LIR3,PIR-B,PIRB
Molecular Weight:: 60-70 kDa
Purity:: ≥95%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Gly24-Glu443
Formulation:: Recombinant Human LILRB3/ILT-5/CD85a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Glu443) of human LILRB3/CD85a/ILT5 (Accession #XP_016885786.1) fused with a 6xHis, Avi tag at the C-terminus.
Species:: Human
Sequence:: GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE
Uniprot:: O75022
Synonyms:: CD85 antigen-like family member A;CD85A;HL9;ILT-5;ILT5;immunoglobulin-like transcript 5;leucocyte Ig-like receptor B3;leukocyte immunoglobulin-like receptor subfamily B member 3;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3;LILRA6;LIR-3;LIR3;monocyte inhibitory receptor HL9;PIR-B;PIRB
Extra Details:: Leukocyte immunoglobulin-like receptor subfamily B member 3, also known as Leukocyte immunoglobulin-like receptor 3, Immunoglobulin-like transcript 5, Monocyte inhibitory receptor HL9, CD85 antigen-like family member A, CD85a and LILRB3, is a single-pass type I membrane protein that belongs to the leukocyte receptor cluster (LRC) present on 19q13.4. LILRB3 / CD85a contains four Ig-like C2-type (immunoglobulin-like) domains. LILRB3 / CD85a contains three copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in the modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. LILRB3 / CD85a is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found.

Shipping Conditions:: Blue Ice