Recombinant Human TNFRSF1A/TNF-R1/CD120a Protein

Size

£133.00

SKU:: RP01412
Additional Names:: TNFRSF1A,CD120a,FPF,TBP1,TNF-R,TNF-R-I,TNF-R55,TNFAR,TNFR1,TNFR55,TNFR60,p55,p55-R,p60
Molecular Weight:: 55-65 kDa
Purity:: ≥90%
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Immunogen:: Leu30-Thr211
Formulation:: Recombinant Human TNFRSF1A/TNF-R1/CD120a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu30-Thr211) of human CD120a/TNFRSF1A (Accession #NP_001056.1) fused with a hFc tag at the C-terminus.
Species:: Human
Sequence:: LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Uniprot:: P19438-1
Synonyms:: CD120a;FPF;p55;p55-R;p60;TBP1;TNF-R;TNF-R-I;TNF-R1;TNF-R55;TNF-RI;TNFAR;TNFR-I;TNFR1;TNFR55;TNFR60;tumor necrosis factor binding protein 1;Tumor necrosis factor receptor 1;tumor necrosis factor receptor superfamily member 1A;tumor necrosis factor receptor type 1;Tumor necrosis factor receptor type I;tumor necrosis factor-alpha receptor
Extra Details:: The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. CD120a (cluste of differentiation 120a), also known as TNFR1 / TNFRSF1A, is a member of CD family, tumor necrosis factor receptor superfamily. CD120a is one of the most primary receptors for the tumor necrosis factor-alpha. It has been shown to be localized to both plasma membrane lipid rafts and the trans golgi complex with the help of the death domain (DD). CD120a can activate the transcription factor NF-K KappaB, mediate apoptosis, and regulate inflammation processes.

Shipping Conditions:: Blue Ice